PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000794G0210
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MIKC_MADS
Protein Properties Length: 273aa    MW: 32099.3 Da    PI: 8.4832
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000794G0210genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF87.29.4e-28959151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     krien++nrqvtfskRr+gilKKA E+ vLCdae+ v+ifss gkly+y+s
  PH01000794G0210  9 KRIENSTNRQVTFSKRRAGILKKAREIGVLCDAEIGVVIFSSAGKLYDYCS 59
                     79***********************************************96 PP

2K-box22.93.7e-0971107137
            K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRh 37 
                      yq++sgk l+++k++sl+ e++++kke++n+q e+R 
  PH01000794G0210  71 YQTNSGKILWDEKHKSLSAEIDRIKKENDNMQIELRP 107
                      79999999*************************9995 PP

3K-box28.85.1e-111391733670
            K-box  36 RhllGedLesLslkeLqqLeqqLekslkkiRskKn 70 
                      Rhl+GedL+sL+ +eL  +e++L+++ ++ R+k+ 
  PH01000794G0210 139 RHLKGEDLNSLQPRELIAIEEALQNGQTNLRDKQA 173
                      9******************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.3E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.324161IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.94E-33296IPR002100Transcription factor, MADS-box
CDDcd002653.72E-43280No hitNo description
PRINTSPR004047.5E-29323IPR002100Transcription factor, MADS-box
PfamPF003198.5E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004047.5E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004047.5E-293859IPR002100Transcription factor, MADS-box
PROSITE profilePS512979.0484233IPR002487Transcription factor, K-box
PfamPF014861.2E-5139173IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MGRGKIEIKR IENSTNRQVT FSKRRAGILK KAREIGVLCD AEIGVVIFSS AGKLYDYCSP  60
KTTLPRILEK YQTNSGKILW DEKHKSLSAE IDRIKKENDN MQIELRPVLH LRFCIFYLYT  120
LRCLRMVRLW WFVPGDGCRH LKGEDLNSLQ PRELIAIEEA LQNGQTNLRD KQAIIGFRMD  180
HWRMHRRNIM EYFLEQELLL VLIIHCLCGW LQEKMLEDEH KLLAFRMHQQ DVELSGGMRE  240
LELGYHHGRD FAPQMPLTFR VQPSHPNLQE DE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-18186178Myocyte-specific enhancer factor 2B
1tqe_Q1e-18186178Myocyte-specific enhancer factor 2B
1tqe_R1e-18186178Myocyte-specific enhancer factor 2B
1tqe_S1e-18186178Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0916091e-145FP091609.1 Phyllostachys edulis cDNA clone: bphyst014n10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001289793.11e-128MADS-box transcription factor 4-like
SwissprotQ407031e-122MADS4_ORYSJ; MADS-box transcription factor 4
TrEMBLA0A140HIF91e-129A0A140HIF9_9POAL; PISTILLATA-like MADS-box transcription factor PI-1
STRINGBRADI2G24940.21e-127(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34343877
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.14e-60MIKC_MADS family protein